Search Antibody, Protein, and ELISA Kit Solutions

RORC Antibody - C-terminal region (ARP33244_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33244_P050-FITC Conjugated

ARP33244_P050-HRP Conjugated

ARP33244_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RORC
Official Gene Full Name:
RAR-related orphan receptor C
NCBI Gene Id:
6097
Protein Name:
Nuclear receptor ROR-gamma
Swissprot Id:
P51449
Protein Accession #:
NP_005051
Nucleotide Accession #:
NM_005060
Alias Symbols:
MGC129539, NR1F3, RORG, RZRG, TOR, RZR-GAMMA
Replacement Item:
This antibody may replace item sc-114336 from Santa Cruz Biotechnology.
Description of Target:
RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
518
Molecular Weight:
58kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RORC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RORC.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RORC
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-RORC (ARP33244_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EVI2A; NCOA6; EIF3I; CHD4; EIF4EBP1;
Blocking Peptide:
For anti-RORC (ARP33244_P050) antibody is Catalog # AAP33244 (Previous Catalog # AAPS22101)
Datasheets/Manuals:
Printable datasheet for anti-RORC (ARP33244_P050) antibody
Target Reference:
Wang,H., et al., (2003) Mol. Genet. Metab. 79 (3), 176-182

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...