Search Antibody, Protein, and ELISA Kit Solutions

RORA Antibody - middle region (ARP45607_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45607_P050-FITC Conjugated

ARP45607_P050-HRP Conjugated

ARP45607_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
RAR-related orphan receptor A
NCBI Gene Id:
Protein Name:
Nuclear receptor ROR-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC119326, MGC119329, NR1F1, ROR1, ROR2, ROR3, RZRA, RZR-ALPHA
Replacement Item:
This antibody may replace item sc-123257 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RORA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RORA.
The immunogen is a synthetic peptide directed towards the middle region of human RORA
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Complete computational species homology data:
Anti-RORA (ARP45607_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RORA (ARP45607_P050) antibody is Catalog # AAP45607 (Previous Catalog # AAPP11886)
Printable datasheet for anti-RORA (ARP45607_P050) antibody
Target Reference:
Boukhtouche,F., (2006) J. Neurochem. 96 (6), 1778-1789

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...