RNF5 Antibody - N-terminal region : FITC (ARP58178_P050-FITC)

Catalog No: ARP58178_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RNF5 (ARP58178_P050-FITC) antibody is Catalog # AAP58178 (Previous Catalog # AAPP32630)
• Sample Type Confirmation:

  RNF5 is supported by BioGPS gene expression data to be expressed in HeLa

• Reference: Bromberg,K.D., (2007) Cancer Res. 67 (17), 8172-8179

Target Info

• Gene Symbol: RNF5
• Gene Full Name: Ring finger protein 5, E3 ubiquitin protein ligase
• Alias Symbols: RMA1, RING5
• NCBI Gene Id: 6048
• Protein Name: E3 ubiquitin-protein ligase RNF5
• Description of Target: RNF5 contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q99942
• Protein Accession #: NP_008844
• Nucleotide Accession #: NM_006913
• Protein Size (# AA): 180
• Molecular Weight: 20kDa
• Protein Interactions: TMEM242; CYB561A3; RNF185; YIPF2; UBE2W; SLC38A7; UBE2D4; INSIG2; SEC22A; UBE2E3; ABHD16A; UBE2E2; UBE2D3; UBE2D1; UBC; SLC1A1; RNF5; UBE2K; CYB561; PTGDR2; ADRB2; PXN; env; TNFAIP3; UBC5; DERL1; UBE2J1; UBE2N; UBE2G2; UBE2D2; CFTR; BCAP31; TMEM173; MAVS;