- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RNF31 (OAAN02647) |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB |
:: | Positive Samples: Jurkat, MCF-7, BT-474, HeLa, PC-3 Cellular Location: Cytoplasm |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human RNF31. |
Purification | Affinity purified |
Peptide Sequence | AAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA |
Application Info | WB: 1:500~2000 |
Gene Symbol | RNF31 |
---|---|
Gene Full Name | ring finger protein 31 |
Alias Symbols | HOIP, Paul, ZIBRA |
NCBI Gene Id | 55072 |
Protein Name | E3 ubiquitin-protein ligase RNF31 |
Description of Target | The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The encoded protein is the E3 ubiquitin-protein ligase component of the linear ubiquitin chain assembly complex. Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | Q96EP0 |
Protein Accession # | NP_001297261.1 |
Nucleotide Accession # | NM_001310332.1 |
Molecular Weight | 120 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RNF31 Antibody (OAAN02647)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "RNF31 Antibody (OAAN02647)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "RNF31 Antibody (OAAN02647)" provided in?
This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RNF31 Antibody (OAAN02647)"?
This target may also be called "HOIP, Paul, ZIBRA" in publications.
-
What is the shipping cost for "RNF31 Antibody (OAAN02647)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RNF31 Antibody (OAAN02647)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RNF31 Antibody (OAAN02647)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "120 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RNF31 Antibody (OAAN02647)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RNF31"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RNF31"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RNF31"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RNF31"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RNF31"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RNF31"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.