- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Human
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- RNF14
- Official Gene Full Name:
- ring finger protein 14
- NCBI Gene Id:
- 9604
- Protein Name:
- E3 ubiquitin-protein ligase RNF14
- Swissprot Id:
- Q9UBS8
- Protein Accession #:
- NP_001188294.1
- Nucleotide Accession #:
- NM_001201365.1
- Alias Symbols:
- ARA54, HFB30, TRIAD2, HRIHFB2038
- Description of Target:
- The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
- Protein Size (# AA):
- 474
- Molecular Weight:
- 52 kDa
- Purification:
- Affinity purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express RNF14.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express RNF14.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14
- Peptide Sequence:
- Synthetic peptide located within the following region: GTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRL
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-RNF14 (ARP82569_P050) antibody is Catalog # AAP82569
- Datasheets/Manuals:
- Printable datasheet for anti-RNF14 (ARP82569_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
