RNF14 Antibody - C-terminal region (ARP82569_P050)

Catalog#: ARP82569_P050
Domestic: within 24 hours delivery International: 3-5 business days

Human Neurofibroma Tumor

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Gene Symbol:: RNF14
Official Gene Full Name:: ring finger protein 14
NCBI Gene Id:: 9604
Protein Name:: E3 ubiquitin-protein ligase RNF14
Swissprot Id:: Q9UBS8
Protein Accession #:: NP_001188294.1
Nucleotide Accession #:: NM_001201365.1
Alias Symbols:: ARA54, HFB30, TRIAD2, HRIHFB2038
Description of Target:: The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Protein Size (# AA):: 474
Molecular Weight:: 52 kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express RNF14.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express RNF14.
Immunogen:: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14
Predicted Species Reactivity:: Human
Tested Species Reactivity:: Human
Peptide Sequence:: Synthetic peptide located within the following region: GTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRL
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:: For anti-RNF14 (ARP82569_P050) antibody is Catalog # AAP82569
Datasheets/Manuals:: Printable datasheet for anti-RNF14 (ARP82569_P050) antibody