Search Antibody, Protein, and ELISA Kit Solutions

RNF14 Antibody - C-terminal region (ARP82569_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RNF14
Official Gene Full Name:
ring finger protein 14
NCBI Gene Id:
9604
Protein Name:
E3 ubiquitin-protein ligase RNF14
Swissprot Id:
Q9UBS8
Protein Accession #:
NP_001188294.1
Nucleotide Accession #:
NM_001201365.1
Alias Symbols:
ARA54, HFB30, TRIAD2, HRIHFB2038
Description of Target:
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Protein Size (# AA):
474
Molecular Weight:
52 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RNF14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RNF14.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14
Peptide Sequence:
Synthetic peptide located within the following region: GTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RNF14 (ARP82569_P050) antibody is Catalog # AAP82569
Datasheets/Manuals:
Printable datasheet for anti-RNF14 (ARP82569_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...