RNF125 Antibody - middle region (ARP43234_P050)

Catalog No: ARP43234_P050

WB Suggested Anti-RNF125 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate

Host: Rabbit
Target Name: RNF125
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: RNF125
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF125
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RNF125 (ARP43234_P050) antibody is Catalog # AAP43234 (Previous Catalog # AAPP11309)

Target Info

• Gene Symbol: RNF125
• Gene Full Name: Ring finger protein 125, E3 ubiquitin protein ligase
• Alias Symbols: TNORS, TRAC1, TRAC-1
• NCBI Gene Id: 54941
• Protein Name: E3 ubiquitin-protein ligase RNF125
• Description of Target: This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
• Uniprot ID: Q96EQ8
• Protein Accession #: NP_060301
• Nucleotide Accession #: NM_017831
• Protein Size (# AA): 232
• Molecular Weight: 26kDa
• Protein Interactions: UBC; USP2; PCGF1; TRIM46; CHFR; PML; UBE2D1; UBE2U; UBE2W; UBE2D4; UBE2L6; UBE2N; UBE2L3; UBE2E2; UBE2D3; UBE2D2; UBE2K;