RNF103 Antibody - middle region (ARP79414_P050)

Catalog No: ARP79414_P050

Host: Rabbit
Target Name: RNF103
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF103
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RNF103 (ARP79414_P050) antibody is Catalog # AAP79414

Target Info

• Gene Symbol: RNF103
• Gene Full Name: ring finger protein 103
• Alias Symbols: KF1, KF-1, HKF-1, ZFP103, ZFP-103
• NCBI Gene Id: 7844
• Protein Name: E3 ubiquitin-protein ligase RNF103
• Description of Target: The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. The protein is a ubiquitin ligase that functions in the endoplasmic reticulum-associated degradation pathway. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream CHMP3 (charged multivesicular body protein 3) gene.
• Uniprot ID: O00237
• Protein Accession #: NP_001185880.1
• Nucleotide Accession #: NM_001198951.1
• Protein Size (# AA): 685
• Molecular Weight: 79 kDa