Search Antibody, Protein, and ELISA Kit Solutions

RNASET2 antibody - middle region (ARP33127_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33127_P050-FITC Conjugated

ARP33127_P050-HRP Conjugated

ARP33127_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ribonuclease T2
Protein Name:
Ribonuclease T2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
RNASE6PL, bA514O12.3, RP11-514O12.3
Replacement Item:
This antibody may replace item sc-109020 from Santa Cruz Biotechnology.
Description of Target:
This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RNASET2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RNASET2.
The immunogen is a synthetic peptide directed towards the middle region of human RNASET2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Horse: 79%; Human: 100%; Rat: 75%
Complete computational species homology data:
Anti-RNASET2 (ARP33127_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RNASET2 (ARP33127_P050) antibody is Catalog # AAP33127 (Previous Catalog # AAPP04160)
Printable datasheet for anti-RNASET2 (ARP33127_P050) antibody
Sample Type Confirmation:

RNASET2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Campomenosi,P., Arch. Biochem. Biophys. 449 (1-2), 17-26 (2006)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...