Search Antibody, Protein, and ELISA Kit Solutions

RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75764_P050 Unconjugated

ARP75764_P050-HRP Conjugated

ARP75764_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
RNASEH2B
Official Gene Full Name:
ribonuclease H2 subunit B
NCBI Gene Id:
79621
Protein Name:
ribonuclease H2 subunit B
Swissprot Id:
Q5TBB1
Protein Accession #:
NP_078846
Alias Symbols:
AGS2, DLEU8
Description of Target:
RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2).
Protein Size (# AA):
312
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RNASEH2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RNASEH2B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNH2B
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; ANP32E; UBQLN2; RDX; DNAJB1; RNASEH2C; RNASEH2A; NRAS;
Blocking Peptide:
For anti-RNASEH2B (ARP75764_P050-FITC) antibody is Catalog # AAP75764
Datasheets/Manuals:
Printable datasheet for anti-RNASEH2B (ARP75764_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...