Size:100 ul
$289.00
In Stock
SKU
ARP75764_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75764_P050 Unconjugated

ARP75764_P050-HRP Conjugated

ARP75764_P050-Biotin Conjugated

RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)

Catalog#: ARP75764_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNH2B
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: SKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSK
Concentration 0.5 mg/ml
Blocking Peptide For anti-RNASEH2B (ARP75764_P050-FITC) antibody is Catalog # AAP75764
Datasheets/Manuals Printable datasheet for anti-RNASEH2B (ARP75764_P050-FITC) antibody
Target Reference N/A
Gene Symbol RNASEH2B
Official Gene Full Name ribonuclease H2 subunit B
Alias Symbols AGS2, DLEU8
NCBI Gene Id 79621
Protein Name ribonuclease H2 subunit B
Description of Target RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2).
Swissprot Id Q5TBB1
Protein Accession # NP_078846
Protein Size (# AA) 312
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RNASEH2B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RNASEH2B.
Protein Interactions UBC; ANP32E; UBQLN2; RDX; DNAJB1; RNASEH2C; RNASEH2A; NRAS;
  1. What is the species homology for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    This target may also be called "AGS2, DLEU8" in publications.

  5. What is the shipping cost for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RNASEH2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RNASEH2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RNASEH2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RNASEH2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RNASEH2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RNASEH2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RNASEH2B Antibody - C-terminal region : FITC (ARP75764_P050-FITC)
Your Rating