Search Antibody, Protein, and ELISA Kit Solutions

RIT2 Antibody - middle region (ARP85441_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RIT2
Official Gene Full Name:
Ras-like without CAAX 2
NCBI Gene Id:
6014
Protein Name:
GTP-binding protein Rit2
Swissprot Id:
Q92963-3
Protein Accession #:
NP_001259006.1
Nucleotide Accession #:
NM_001272077.1
Alias Symbols:
RIN, RIBA, ROC2
Description of Target:
RIN belongs to the RAS superfamily of small GTPases.
Protein Size (# AA):
236
Molecular Weight:
25 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RIT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RIT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RIT2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RIT2 (ARP85441_P050) antibody is Catalog # AAP85441
Datasheets/Manuals:
Printable datasheet for anti-RIT2 (ARP85441_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...