- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for RIN2 Antibody (OAAL00707) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1E6 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | RIN2 (NP_061866, 786 a.a. ~ 894 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | RIN2 |
---|---|
Gene Full Name | Ras and Rab interactor 2 |
Alias Symbols | MACS;RAB5 interacting protein 2;ras and Rab interactor 2;RAS association (RalGDS/AF-6) domain containing protein JC265;RAS association domain family 4;RAS inhibitor JC265;RAS interaction/interference protein 2;RASSF4. |
NCBI Gene Id | 54453 |
Protein Name | Homo sapiens Ras and Rab interactor 2 (RIN2), transcript variant 2, mRNA|ras and Rab interactor 2 isoform 2 [Homo sapiens] |
Description of Target | The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_061866 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_018993 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RIN2 Antibody (OAAL00707)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "RIN2 Antibody (OAAL00707)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "RIN2 Antibody (OAAL00707)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RIN2 Antibody (OAAL00707)"?
This target may also be called "MACS;RAB5 interacting protein 2;ras and Rab interactor 2;RAS association (RalGDS/AF-6) domain containing protein JC265;RAS association domain family 4;RAS inhibitor JC265;RAS interaction/interference protein 2;RASSF4." in publications.
-
What is the shipping cost for "RIN2 Antibody (OAAL00707)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RIN2 Antibody (OAAL00707)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RIN2 Antibody (OAAL00707)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RIN2 Antibody (OAAL00707)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RIN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RIN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RIN2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RIN2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RIN2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RIN2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.