RIBOFLAVIN-BINDING PROTEIN Recombinant Protein (Chicken) (OPCA04152)

Catalog No: OPCA04152

Product Info

• Predicted Species Reactivity: Chicken|Gallus gallus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Gallus gallus (Chicken)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK
• Protein Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 18-225 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988)
• Gene Symbol: RBP
• Gene Full Name: riboflavin binding protein
• Alias Symbols: Rd;retbindin;riboflavin-binding protein;RTBDN.
• NCBI Gene Id: 396449
• Protein Name: Riboflavin-binding protein
• Description of Target: Required for the transport of riboflavin to the developing oocyte.
• Uniprot ID: P02752
• Protein Accession #: NP_990794
• Nucleotide Accession #: NM_205463
• Protein Size (# AA): Recombinant
• Molecular Weight: 25.8 kDa