Search Antibody, Protein, and ELISA Kit Solutions

RHOT1 Antibody - N-terminal region (ARP44817_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44817_P050-FITC Conjugated

ARP44817_P050-HRP Conjugated

ARP44817_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Ras homolog family member T1
NCBI Gene Id:
Protein Name:
Mitochondrial Rho GTPase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ARHT1, FLJ11040, FLJ12633, MIRO-1, MIRO1
Replacement Item:
This antibody may replace item sc-102083 from Santa Cruz Biotechnology.
Description of Target:
Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RHOT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RHOT1.
The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-RHOT1 (ARP44817_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RHOT1 (ARP44817_P050) antibody is Catalog # AAP44817 (Previous Catalog # AAPP12293)
Printable datasheet for anti-RHOT1 (ARP44817_P050) antibody
Target Reference:
Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:07
  • Overall Experience:
  • Quality:
HeLa Cell Lysates in WB

Submitted by: 

Jarom Chung
Children's Hospital (Boston), Schwarz Lab.


Sample type: HeLa cells transfected with Lipofectamine. 6% of cell lysate loaded.
Lane 1: HeLa cells transfected with Lipofectamine
Lane 2: HeLa cells transfected with Lipofectamine
Lane 3: HeLa cells transfected with Lipofectamine

Primary antibody dilution: 1:1000

Secondary antibody and dilution: Cy5 anti-Rabbit, 1:5000

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...