Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP42413_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42413_P050-FITC Conjugated

ARP42413_P050-HRP Conjugated

ARP42413_P050-Biotin Conjugated

RHOD Antibody - N-terminal region (ARP42413_P050)

Catalog#: ARP42413_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-27879 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RHOD
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 79%; Human: 100%; Rat: 79%
Complete computational species homology data Anti-RHOD (ARP42413_P050)
Peptide Sequence Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RHOD (ARP42413_P050) antibody is Catalog # AAP42413 (Previous Catalog # AAPP24759)
Datasheets/Manuals Printable datasheet for anti-RHOD (ARP42413_P050) antibody
Target Reference Tong,Y., (2007) J. Biol. Chem. 282 (51), 37215-37224
Gene Symbol RHOD
Official Gene Full Name Ras homolog family member D
Alias Symbols ARHD, RHOHP1, RHOM, Rho
NCBI Gene Id 29984
Protein Name Rho-related GTP-binding protein RhoD
Description of Target Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O00212
Protein Accession # NP_055393
Nucleotide Accession # NM_014578
Protein Size (# AA) 210
Molecular Weight 23kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RHOD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RHOD.
Protein Interactions ADRB2; IHH; ADCK5; UBC; PLXNA1; SMURF2; BMPR1B; SMAD2; SMAD4; DIAPH2; TGFBR1; HRAS; ACVR1; CNKSR1; ARHGAP29;
Write Your Own Review
You're reviewing:RHOD Antibody - N-terminal region (ARP42413_P050)
Your Rating