Search Antibody, Protein, and ELISA Kit Solutions

RHOD antibody - N-terminal region (ARP42413_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42413_P050-FITC Conjugated

ARP42413_P050-HRP Conjugated

ARP42413_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ras homolog family member D
Protein Name:
Rho-related GTP-binding protein RhoD
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-27879 from Santa Cruz Biotechnology.
Description of Target:
Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RHOD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RHOD.
The immunogen is a synthetic peptide directed towards the N terminal region of human RHOD
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 79%; Human: 100%; Rat: 79%
Complete computational species homology data:
Anti-RHOD (ARP42413_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RHOD (ARP42413_P050) antibody is Catalog # AAP42413 (Previous Catalog # AAPP24759)
Printable datasheet for anti-RHOD (ARP42413_P050) antibody
Target Reference:
Tong,Y., (2007) J. Biol. Chem. 282 (51), 37215-37224

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...