Search Antibody, Protein, and ELISA Kit Solutions

RHOC Antibody - middle region (ARP87103_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ras homolog family member C
NCBI Gene Id:
Protein Name:
Rho-related GTP-binding protein RhoC
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein Size (# AA):
Molecular Weight:
21 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RHOC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RHOC.
The immunogen is a synthetic peptide directed towards the middle region of human RHOC
Peptide Sequence:
Synthetic peptide located within the following region: LVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RHOC (ARP87103_P050) antibody is Catalog # AAP87103
Printable datasheet for anti-RHOC (ARP87103_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...