RHOBTB3 Antibody - N-terminal region : FITC (ARP74182_P050-FITC)

Catalog No: ARP74182_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHBT3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RHOBTB3 (ARP74182_P050-FITC) antibody is Catalog # AAP74182
• Reference: N/A

Target Info

• Gene Symbol: RHOBTB3
• Gene Full Name: Rho related BTB domain containing 3
• Alias Symbols: KIAA0878
• NCBI Gene Id: 22836
• Protein Name: rho-related BTB domain-containing protein 3
• Description of Target: RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1 (MIM 607351).[supplied by OMIM, Apr 2004]
• Uniprot ID: O94955
• Protein Accession #: NP_055714
• Protein Size (# AA): 611
• Molecular Weight: 67kDa
• Protein Interactions: RBPMS; BHLHE40; UBXN11; RBX1; CCNA1; CUL3; CCNE1; CCNB1; UBC; PLIN3; RAB9A; RHOBTB2; RHOBTB3; Lrrc41; HTR7; HGS;