Search Antibody, Protein, and ELISA Kit Solutions

RHOA Antibody - middle region (ARP58521_P050)

  • Catalog#: ARP58521_P050
  • Inquire
100 ul
Request Bulk Order Quote

Conjugation Options

ARP58521_P050-FITC Conjugated

ARP58521_P050-HRP Conjugated

ARP58521_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Ras homolog family member A
NCBI Gene Id:
Protein Name:
Transforming protein RhoA
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-166399 from Santa Cruz Biotechnology.
Description of Target:
RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. RHOA serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. It may be an activator of PLCE1. RHOA is activated by ARHGEF2, which promotes the exchange of GDP for GTP.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RHOA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RHOA.
The immunogen is a synthetic peptide directed towards the middle region of human RHOA
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-RHOA (ARP58521_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RHOA (ARP58521_P050) antibody is Catalog # AAP58521 (Previous Catalog # AAPP34503)
Printable datasheet for anti-RHOA (ARP58521_P050) antibody
Target Reference:
Kakinuma,N., (2008) J. Cell Biol. 181 (3), 537-549

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...