Size:100 ul
Special Price $229.00 Regular Price $289.00
Discontinued
SKU
ARP58521_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58521_P050-FITC Conjugated

ARP58521_P050-HRP Conjugated

ARP58521_P050-Biotin Conjugated

RHOA Antibody - middle region (ARP58521_P050)

Catalog#: ARP58521_P050
Inquire
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166399 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RHOA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data Anti-RHOA (ARP58521_P050)
Peptide Sequence Synthetic peptide located within the following region: GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RHOA (ARP58521_P050) antibody is Catalog # AAP58521 (Previous Catalog # AAPP34503)
Datasheets/Manuals Printable datasheet for anti-RHOA (ARP58521_P050) antibody
Target Reference Kakinuma,N., (2008) J. Cell Biol. 181 (3), 537-549
Gene Symbol RHOA
Official Gene Full Name Ras homolog family member A
Alias Symbols ARH12, ARHA, RHO12, RHOH12
NCBI Gene Id 387
Protein Name Transforming protein RhoA
Description of Target RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. RHOA serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. It may be an activator of PLCE1. RHOA is activated by ARHGEF2, which promotes the exchange of GDP for GTP.
Swissprot Id P61586
Protein Accession # NP_001655
Nucleotide Accession # NM_001664
Protein Size (# AA) 193
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RHOA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RHOA.
Protein Interactions KCTD13; IKZF3; FAM65B; CUL3; UBC; TRIP6; TNFAIP1; ARHGDIA; IKBKG; BIRC2; TBXA2R; SMAD2; ARHGAP1; CDKN1B; PKN1; BAIAP2; GNB2L1; ARHGEF11; RPN2; ARHGEF12; DIAPH3; PLIN3; NUBP2; PRDX6; RPS27A; RPL18; PON2; PPP1R12A; MPV17; DDX1; CPT1A; CLNS1A; SLC25A5; LRRK2
  1. What is the species homology for "RHOA Antibody - middle region (ARP58521_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "RHOA Antibody - middle region (ARP58521_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RHOA Antibody - middle region (ARP58521_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RHOA Antibody - middle region (ARP58521_P050)"?

    This target may also be called "ARH12, ARHA, RHO12, RHOH12" in publications.

  5. What is the shipping cost for "RHOA Antibody - middle region (ARP58521_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RHOA Antibody - middle region (ARP58521_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RHOA Antibody - middle region (ARP58521_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RHOA Antibody - middle region (ARP58521_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RHOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RHOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RHOA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RHOA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RHOA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RHOA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RHOA Antibody - middle region (ARP58521_P050)
Your Rating
We found other products you might like!