Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP72397_P050
Price: $0.00
SKU
ARP72397_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP72397_P050
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityRat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Rat RHOA
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: AKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP72397
Gene SymbolRHOA
Alias SymbolsArha, Arha2
NCBI Gene Id117273
Description of TargetRHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It is involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. It plays an essential role in cleavage furrow formation. It is required for the apical junction formation of keratinocyte cell-cell adhesion. It may be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. It is essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis.
Uniprot IDP61589
Protein Accession #XP_006243763.1
Protein Size (# AA)193
Molecular Weight21 kDa
  1. What is the species homology for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Rat".

  2. How long will it take to receive "RHOA Antibody - C-terminal (ARP72397_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "RHOA Antibody - C-terminal (ARP72397_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    This target may also be called "Arha, Arha2" in publications.

  5. What is the shipping cost for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RHOA Antibody - C-terminal (ARP72397_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RHOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RHOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RHOA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RHOA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RHOA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RHOA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RHOA Antibody - C-terminal (ARP72397_P050)
Your Rating
We found other products you might like!