- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for RHAG Antibody (OAAF08140) Please click here to view the MSDS. |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Product Format | Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from the N-terminal region of human RHAG. |
| Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFEL |
| Concentration | 1 mg/ml |
| Specificity | RHAG Antibody detects endogenous levels of RHAG protein. |
| Intended Use | The product is for research use only, not for use in diagnostic or therapeutic procedures. |
| Application Info | WB: 1:500~1000 ELISA: 1:10000 |
| Gene Symbol | RHAG |
|---|---|
| Gene Full Name | Rh associated glycoprotein |
| Alias Symbols | ammonium transporter Rh type A;CD241;erythrocyte membrane glycoprotein Rh50;erythrocyte plasma membrane 50 kDa glycoprotein;mutant Rh associated glycoprotein;OHS;OHST;Rh 50 glycoprotein;rh family type A glycoprotein;rh type A glycoprotein;RH2;Rh50;RH50A;Rh50GP;Rhesus associated polypeptide, 50-KD;rhesus blood group family type A glycoprotein;rhesus blood group-associated ammonia channel;Rhesus blood group-associated glycoprotein;RHNR;SLC42A1;truncated RhAG glycoprotein;truncated Rh-associated glycoprotein. |
| NCBI Gene Id | 6005 |
| Protein Name | Ammonium transporter Rh type A |
| Description of Target | Associated with rhesus blood group antigen expression (PubMed:19744193). May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane (PubMed:11062476, PubMed:11861637). Involved in ammonia transport across the erythrocyte membrane (PubMed:21849667, PubMed:22012326). Seems to act in monovalent cation transport (PubMed:18931342, PubMed:21849667). |
| Uniprot ID | Q02094 |
| Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RHAG Antibody (OAAF08140)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "RHAG Antibody (OAAF08140)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "RHAG Antibody (OAAF08140)" provided in?
This item is provided in "Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RHAG Antibody (OAAF08140)"?
This target may also be called "ammonium transporter Rh type A;CD241;erythrocyte membrane glycoprotein Rh50;erythrocyte plasma membrane 50 kDa glycoprotein;mutant Rh associated glycoprotein;OHS;OHST;Rh 50 glycoprotein;rh family type A glycoprotein;rh type A glycoprotein;RH2;Rh50;RH50A;Rh50GP;Rhesus associated polypeptide, 50-KD;rhesus blood group family type A glycoprotein;rhesus blood group-associated ammonia channel;Rhesus blood group-associated glycoprotein;RHNR;SLC42A1;truncated RhAG glycoprotein;truncated Rh-associated glycoprotein." in publications.
-
What is the shipping cost for "RHAG Antibody (OAAF08140)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RHAG Antibody (OAAF08140)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RHAG Antibody (OAAF08140)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RHAG Antibody (OAAF08140)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RHAG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RHAG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RHAG"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RHAG"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RHAG"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RHAG"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
