Search Antibody, Protein, and ELISA Kit Solutions

RGS6 antibody - C-terminal region (ARP34043_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34043_P050-FITC Conjugated

ARP34043_P050-HRP Conjugated

ARP34043_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Regulator of G-protein signaling 6
Protein Name:
Regulator of G-protein signaling 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-271643 from Santa Cruz Biotechnology.
Description of Target:
Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RGS6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RGS6.
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS6
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-RGS6 (ARP34043_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RGS6 (ARP34043_P050) antibody is Catalog # AAP34043 (Previous Catalog # AAPP05123)
Printable datasheet for anti-RGS6 (ARP34043_P050) antibody
Target Reference:
Liu,Z. et al., (2004) J. Biol. Chem. 279 (14), 14120-14128

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...