RGS5 Antibody - middle region : FITC (AVARP09015_P050-FITC)

Catalog No: AVARP09015_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGS5
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 84%; Pig: 76%; Rat: 84%
• Peptide Sequence: Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RGS5 (AVARP09015_P050-FITC) antibody is Catalog # AAP30214 (Previous Catalog # AAPP00371)
• Reference: Campbell,D.B., (er) Schizophr. Res. (2008) In press

Target Info

• Gene Symbol: RGS5
• Gene Full Name: Regulator of G-protein signaling 5
• Alias Symbols: MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
• NCBI Gene Id: 8490
• Protein Name: Regulator of G-protein signaling 5
• Description of Target: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 AU130764.1 1-663 664-2587 BX537427.1 499-2422 2588-3235 BU187973.1 34-681 3236-3746 AL600981.1 90-600 3747-4143 AA486366.1 76-472 4144-4358 AA974387.1 113-327 c 4359-4664 BX537427.1 4194-4499 4665-5573 AF176919.1 724-1632 5574-5848 BX537427.1 5409-5683
• Uniprot ID: O15539
• Protein Accession #: NP_003608
• Nucleotide Accession #: NM_003617
• Protein Size (# AA): 181
• Molecular Weight: 21kDa
• Protein Interactions: ADRB2; APP; GNAQ; GNAI3; GNAI2; GNAO1; GNAI1;