Search Antibody, Protein, and ELISA Kit Solutions

RGS3 Antibody - C-terminal region : HRP (AVARP09007_T100-HRP)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP09007_T100 Unconjugated

AVARP09007_T100-FITC Conjugated

AVARP09007_T100-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
RGS3
Official Gene Full Name:
Regulator of G-protein signaling 3
NCBI Gene Id:
5998
Protein Name:
Regulator of G-protein signaling 3
Swissprot Id:
P49796
Protein Accession #:
NP_066929
Nucleotide Accession #:
NM_021106
Alias Symbols:
C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Replacement Item:
This antibody may replace item sc-100762 from Santa Cruz Biotechnology.
Description of Target:
RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
Protein Size (# AA):
519
Molecular Weight:
57kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RGS3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RGS3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-RGS3 (AVARP09007_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Concentration:
0.5 mg/ml
Protein Interactions:
GORASP2; UBC; PLSCR1; SUMO2; HES4; GNAI2; GNA11; APP; ACD; ARRB1; Nedd4; IRF5; ISG15; CNKSR2; PAX6; GLS2; YWHAE; HIPK3; PARK2; MAPK12; RGS3; YWHAB; YWHAZ; EFNB2; SCN5A; EFNB1; YWHAQ; GNAI3; GRIN2A; ESR1;
Blocking Peptide:
For anti-RGS3 (AVARP09007_T100-HRP) antibody is Catalog # AAP30212 (Previous Catalog # AAPP00369)
Datasheets/Manuals:
Printable datasheet for anti-RGS3 (AVARP09007_T100-HRP) antibody
Specificity:
Isoforms 1-4 & 6 of P49796
Target Reference:
Druey, K. M., et al., (1996) Nature 379:742-746.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...