Search Antibody, Protein, and ELISA Kit Solutions

RGS3 Antibody - C-terminal region (AVARP09007_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP09007_T100-FITC Conjugated

AVARP09007_T100-HRP Conjugated

AVARP09007_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Regulator of G-protein signaling 3
NCBI Gene Id:
Protein Name:
Regulator of G-protein signaling 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Replacement Item:
This antibody may replace item sc-100762 from Santa Cruz Biotechnology.
Description of Target:
RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RGS3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RGS3.
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-RGS3 (AVARP09007_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RGS3 (AVARP09007_T100) antibody is Catalog # AAP30212 (Previous Catalog # AAPP00369)
Printable datasheet for anti-RGS3 (AVARP09007_T100) antibody
Isoforms 1-4 & 6 of P49796
Target Reference:
Druey, K. M., et al., (1996) Nature 379:742-746.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...