Search Antibody, Protein, and ELISA Kit Solutions

RGS3 Antibody - C-terminal region (AVARP09007_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP09007_T100-FITC Conjugated

AVARP09007_T100-HRP Conjugated

AVARP09007_T100-Biotin Conjugated

Gene Symbol:
RGS3
Official Gene Full Name:
Regulator of G-protein signaling 3
NCBI Gene Id:
5998
Protein Name:
Regulator of G-protein signaling 3
Swissprot Id:
P49796
Protein Accession #:
NP_066929
Nucleotide Accession #:
NM_021106
Alias Symbols:
C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Replacement Item:
This antibody may replace item sc-100762 from Santa Cruz Biotechnology.
Description of Target:
RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
Protein Size (# AA):
519
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RGS3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RGS3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RGS3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-RGS3 (AVARP09007_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GORASP2; UBC; PLSCR1; SUMO2; HES4; GNAI2; GNA11; APP; ACD; ARRB1; Nedd4; IRF5; ISG15; CNKSR2; PAX6; GLS2; YWHAE; HIPK3; PARK2; MAPK12; RGS3; YWHAB; YWHAZ; EFNB2; SCN5A; EFNB1; YWHAQ; GNAI3; GRIN2A; ESR1;
Blocking Peptide:
For anti-RGS3 (AVARP09007_T100) antibody is Catalog # AAP30212 (Previous Catalog # AAPP00369)
Datasheets/Manuals:
Printable datasheet for anti-RGS3 (AVARP09007_T100) antibody
Specificity:
Isoforms 1-4 & 6 of P49796
Target Reference:
Druey, K. M., et al., (1996) Nature 379:742-746.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...