RGS17 Antibody - C-terminal region : HRP (ARP34049_P050-HRP)

Catalog No: ARP34049_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RGS17
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RGS17 (ARP34049_P050-HRP) antibody is Catalog # AAP34049

Target Info

• Gene Symbol: RGS17
• Gene Full Name: regulator of G-protein signaling 17
• Alias Symbols: RGSZ2, RGS-17, hRGS17
• NCBI Gene Id: 26575
• Protein Name: Regulator of G-protein signaling 17
• Description of Target: This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
• Uniprot ID: Q9UGC6
• Protein Accession #: NP_036551
• Nucleotide Accession #: NM_012419
• Protein Size (# AA): 210
• Molecular Weight: 23kDa
• Protein Interactions: LCE3C; LCE2A; LCE4A; TBC1D16; DHX37; NUFIP2; PTGER3; OTX1; RPL10A; SMCP; HOXA1; GNAI3; GNAI1; AQP1; ADRB2; RABEP1; RBBP8; UBC; OSTM1;