Search Antibody, Protein, and ELISA Kit Solutions

RGS12 Antibody - middle region (ARP79162_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RGS12
Official Gene Full Name:
regulator of G-protein signaling 12
NCBI Gene Id:
6002
Protein Name:
regulator of G-protein signaling 12
Swissprot Id:
E9PBG5
Protein Accession #:
NP_002917.1
Replacement Item:
This antibody may replace item sc-17739 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the 'regulator of G protein signaling' (RGS) gene family. The encoded protein may function as a guanosine triphosphatase (GTPase)-activating protein as well as a transcriptional repressor. This protein may play a role in tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their biological nature has not been determined.
Protein Size (# AA):
667
Molecular Weight:
73 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RGS12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RGS12.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RGS12
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: WQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RGS12 (ARP79162_P050) antibody is Catalog # AAP79162
Datasheets/Manuals:
Printable datasheet for anti-RGS12 (ARP79162_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...