Catalog No: AVARP09013_T100-HRP
Size:100ul
Price: $384.00
SKU
AVARP09013_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-RGS10 (AVARP09013_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RGS10
Predicted Homology Based on Immunogen SequenceCow: 81%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Concentration0.5 mg/ml
Blocking PeptideFor anti-RGS10 (AVARP09013_T100-HRP) antibody is Catalog # AAP30209
Sample Type Confirmation

There is BioGPS gene expression data showing that RGS10 is expressed in Jurkat

ReferenceOh,J.H., et al., (2005) Mamm. Genome 16 (12), 942-954
Gene SymbolRGS10
Gene Full NameRegulator of G-protein signaling 10
NCBI Gene Id6001
Protein NameRegulator of G-protein signaling 10
Description of TargetRegulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ96GN0
Protein Accession #NP_001005339
Nucleotide Accession #NM_001005339
Protein Size (# AA)181
Molecular Weight21kDa
Protein InteractionsUBC; ADRB2; APP; PRKACA; GNAI3; GNAO1; GNAI1; GNAZ; GNRHR; CALM1; ACP6; SAP18; EIF6;
  1. What is the species homology for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RGS10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RGS10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RGS10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RGS10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RGS10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RGS10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RGS10 Antibody - middle region : HRP (AVARP09013_T100-HRP)
Your Rating