Loading...
Catalog No: AVARP09013_P050
Price: $0.00
SKU
AVARP09013_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RGS10 (AVARP09013_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationFACS, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RGS10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 81%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Concentration0.5 mg/ml
Blocking PeptideFor anti-RGS10 (AVARP09013_P050) antibody is Catalog # AAP30209 (Previous Catalog # AAPP00366)
Sample Type Confirmation

There is BioGPS gene expression data showing that RGS10 is expressed in Jurkat

ReferenceChatterjee,T.K. et al., (2000) J. Biol. Chem. 275 (31), 24013-24021
Gene SymbolRGS10
Gene Full NameRegulator of G-protein signaling 10
NCBI Gene Id6001
Protein NameRegulator of G-protein signaling 10
Description of TargetRGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.
Uniprot IDQ96GN0
Protein Accession #NP_001005339
Nucleotide Accession #NM_001005339
Protein Size (# AA)181
Molecular Weight21kDa
Protein InteractionsUBC; ADRB2; APP; PRKACA; GNAI3; GNAO1; GNAI1; GNAZ; GNRHR; CALM1; ACP6; SAP18; EIF6;
  1. What is the species homology for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RGS10 Antibody - middle region (AVARP09013_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RGS10 Antibody - middle region (AVARP09013_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RGS10 Antibody - middle region (AVARP09013_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RGS10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RGS10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RGS10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RGS10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RGS10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RGS10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RGS10 Antibody - middle region (AVARP09013_P050)
Your Rating
We found other products you might like!