RFXAP Antibody (OAAL00281)

Catalog No: OAAL00281

Size:100UG

Western Blot analysis of RFXAP expression in transfected 293T cell line by RFXAP monoclonal antibody (M01), clone 1B5.
Lane 1: RFXAP transfected lysate (Predicted MW: 28.3 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged RFXAP is approximately 3ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1B5
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: RFXAP (NP_000529, 179 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: RFXAP
• Gene Full Name: regulatory factor X associated protein
• Alias Symbols: regulatory factor X-associated protein;RFX DNA-binding complex 36 kDa subunit;RFX-associated protein.
• NCBI Gene Id: 5994
• Protein Name: Homo sapiens regulatory factor X associated protein (RFXAP), mRNA|regulatory factor X-associated protein [Homo sapiens]
• Description of Target: Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_000529
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_000538