RFXAP Antibody - middle region (ARP88665_P050)

Catalog No: ARP88665_P050

Host: Rabbit
Target Name: RFXAP
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFXAP
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RFXAP (ARP88665_P050) antibody is Catalog # AAP88665

Target Info

• Gene Symbol: RFXAP
• Gene Full Name: regulatory factor X associated protein
• NCBI Gene Id: 5994
• Protein Name: regulatory factor X-associated protein
• Description of Target: Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene.
• Uniprot ID: O00287
• Protein Accession #: NP_000529.1
• Nucleotide Accession #: NM_000538.3
• Protein Size (# AA): 272
• Molecular Weight: 29 kDa