RFX2 Antibody - middle region (ARP38004_P050)

Catalog No: ARP38004_P050

WB Suggested Anti-RFX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFX2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RFX2 (ARP38004_P050) antibody is Catalog # AAP38004 (Previous Catalog # AAPP20178)
• Reference: Horvath,G.C., (2004) Biol. Reprod. 71 (5), 1551-1559

Target Info

• Gene Symbol: RFX2
• Gene Full Name: Regulatory factor X, 2 (influences HLA class II expression)
• Alias Symbols: FLJ14226
• NCBI Gene Id: 5990
• Protein Name: DNA-binding protein RFX2
• Description of Target: RFX2 is a member of transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX2 is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites.
• Uniprot ID: P48378
• Protein Accession #: NP_000626
• Nucleotide Accession #: NM_000635
• Protein Size (# AA): 723
• Molecular Weight: 80kDa
• Protein Interactions: RFX6; MDFI; RFX4; RFX1; RFX2;