Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP64673_P050 Unconjugated

ARP64673_P050-HRP Conjugated

ARP64673_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
riboflavin kinase
NCBI Gene Id:
Protein Name:
Riboflavin kinase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Riboflavin kinase is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesi.
Protein Size (# AA):
Molecular Weight:
17 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RFK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RFK.
The immunogen is a synthetic peptide directed towards the middle region of human RFK
Predicted Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-RFK (ARP64673_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RFK (ARP64673_P050-FITC) antibody is Catalog # AAP64673
Printable datasheet for anti-RFK (ARP64673_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...