Size:100 ul
$319.00
In Stock
SKU
ARP64673_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64673_P050 Unconjugated

ARP64673_P050-HRP Conjugated

ARP64673_P050-Biotin Conjugated

RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)

Catalog#: ARP64673_P050-FITC
Domestic: within 24 hours delivery | International: 3-5 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RFK
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data Anti-RFK (ARP64673_P050)
Peptide Sequence Synthetic peptide located within the following region: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV
Concentration 0.5 mg/ml
Blocking Peptide For anti-RFK (ARP64673_P050-FITC) antibody is Catalog # AAP64673
Datasheets/Manuals Printable datasheet for anti-RFK (ARP64673_P050-FITC) antibody
Gene Symbol RFK
Official Gene Full Name riboflavin kinase
Alias Symbols RIFK
NCBI Gene Id 55312
Protein Name Riboflavin kinase
Description of Target Riboflavin kinase is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesi.
Swissprot Id Q969G6
Protein Accession # NP_060809
Nucleotide Accession # NM_018339.5
Protein Size (# AA) 155
Molecular Weight 17 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RFK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RFK.
Protein Interactions UBC; DNAJB9; RAB1A;
  1. What is the species homology for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    This target may also be called "RIFK" in publications.

  5. What is the shipping cost for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RFK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RFK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RFK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RFK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RFK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RFK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RFK Antibody - N-terminal region : FITC (ARP64673_P050-FITC)
Your Rating
We found other products you might like!