Search Antibody, Protein, and ELISA Kit Solutions

RFC3 Antibody - C-terminal region (ARP46084_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46084_P050-FITC Conjugated

ARP46084_P050-HRP Conjugated

ARP46084_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Replication factor C (activator 1) 3, 38kDa
NCBI Gene Id:
Protein Name:
Replication factor C subunit 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC5276, RFC38
Replacement Item:
This antibody may replace item sc-20995 from Santa Cruz Biotechnology.
Description of Target:
The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RFC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RFC3.
The immunogen is a synthetic peptide directed towards the C terminal region of human RFC3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-RFC3 (ARP46084_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RFC3 (ARP46084_P050) antibody is Catalog # AAP46084 (Previous Catalog # AAPP26946)
Printable datasheet for anti-RFC3 (ARP46084_P050) antibody
Sample Type Confirmation:

RFC3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
You,K.T., PLoS Biol. 5 (5), E109 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...