SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42039_T100
Price: $0.00
SKU
ARP42039_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MMP1 (ARP42039_T100) antibody
Product Info
Tested Species ReactivityHuman, Horse
Predicted Species ReactivityHuman, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHorse: 77%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Concentration1.0 mg/ml
Blocking PeptideFor anti-MMP1 (ARP42039_T100) antibody is Catalog # AAP42039 (Previous Catalog # AAPP24520)
Other Applications Image 1 DataIHC Suggested Anti-MMP1 antibody
Titration: 2.5 ug/ml
Positive Control: Control-Human liver, Sample-human colorectal cancer
ReferenceMontero,I., (2006) J. Am. Coll. Cardiol. 47 (7), 1369-1378
Gene SymbolMMP1
Gene Full NameMatrix metallopeptidase 1 (interstitial collagenase)
Alias SymbolsCLG, CLGN
NCBI Gene Id4312
Protein NameInterstitial collagenase
Description of TargetProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Uniprot IDP03956
Protein Accession #NP_002412
Nucleotide Accession #NM_002421
Protein Size (# AA)469
Molecular Weight54kDa
Protein InteractionsSOX8; UBC; TNFSF11; CCL13; BCAN; TIMP1; ITGA2; MMP7; CCL7; CCL2; ACAN; TFPI; IGFBP3; COL2A1; CMA1; BSG; SERPINA3; CD44; F2R;
  1. What is the species homology for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    The tested species reactivity for this item is "Human, Horse". This antibody is predicted to have homology to "Human, Horse".

  2. How long will it take to receive "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MMP1 Antibody - N-terminal region (ARP42039_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    This target may also be called "CLG, CLGN" in publications.

  5. What is the shipping cost for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MMP1 Antibody - N-terminal region (ARP42039_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MMP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MMP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MMP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MMP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MMP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MMP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MMP1 Antibody - N-terminal region (ARP42039_T100)
Your Rating
We found other products you might like!