website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GATA2 antibody - N-terminal region (ARP31855_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $229.00

Special Price: $115.00

In Stock

Conjugation Options

ARP31855_T100-FITC Conjugated

ARP31855_T100-HRP Conjugated

ARP31855_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
GATA binding protein 2
Protein Name:
Endothelial transcription factor GATA-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1235 from Santa Cruz Biotechnology.
Description of Target:
The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GATA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GATA2.
The immunogen is a synthetic peptide directed towards the N terminal region of human GATA2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GATA2 (ARP31855_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GATA2 (ARP31855_T100) antibody is Catalog # AAP31855 (Previous Catalog # AAPP02650)
Datasheets / Downloads:
Printable datasheet for anti-GATA2 (ARP31855_T100) antibody
Sample Type Confirmation:

GATA2 is strongly supported by BioGPS gene expression data to be expressed in K562

Target Reference:
Tsuzuki, S., et al., (2004) Mol. Cell. Biol. 24 (15), 6824-6836

Mammoto, A. et al. A mechanosensitive transcriptional mechanism that controls angiogenesis. Nature 457, 1103-8 (2009). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 19242469

Huang, Y.-J. et al. The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer. Mutat. Res. 702, 32-9 (2010). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 20599521

Jack, B. H. A. & Crossley, M. GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis. J. Biol. Chem. 285, 32405-14 (2010). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 20705609

Fujiwara, T. et al. Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells. PLoS One 7, e40959 (2012). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 23028422

Wang, F. et al. A regulatory circuit comprising GATA1/2 switch and microRNA-27a/24 promotes erythropoiesis. Nucleic Acids Res. 42, 442-57 (2014). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 24049083

Product Protocols: GATA2 antibody tested with Human K562 Cells (ARP31855_T100)

Aviva Systems Biology is the original manufacturer of this GATA2 antibody (ARP31855_T100)

Click here to view the GATA2 antibody Western Blot Protocol

Product Datasheet Link: GATA2 antibody (ARP31855_T100)

WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0ug/ml
ELISA Titer: 1:1562500
Positive Control: k562

Western Blot image:

Description of Target: The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GATA2 antibody (ARP31855_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GATA2 antibody tested by IHC with human liver (ARP31855)

Aviva Systems Biology is the original manufacturer of this GATA2 antibody.

Click here to view the GATA2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GATA2 antibody (ARP31855)

IHC Information:

Rabbit Anti-GATA2 Antibody
Catalog Number: ARP31855
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: GATA2 antibody - N-terminal region (ARP31855_T100) in mouse liver and N2a cell lysate using Western Blot

Product Page for GATA2 antibody - N-terminal region (ARP31855_T100)

Researcher: A Kalyani and Vinayak Gupta IIT Madras
Application: Western Blotting
Species+tissue/cell type: Lane 1: 30ug mouse liver lysate
Lane 2: 30ug mouse N2a cell lysate
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:2500

How do Aviva’s reagents play a role in your experimental goals?Its useful in showing the expression levels of the target gene in our experimental plan
How would you rate this antibody on a scale from 1-5 (5=best) nad why?4
Would you use this antibody in future experiment?Yes
Have you used another antibody which has worked in your application?No
Do you believe the information about the reagent on Aviva’s website is correct?Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?Yes
How did you store the antibody after re-suspension?In aliquots in minus twenty freezer
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):Mouse liver tissue and mouse neuriblastoma cell lysate, ~30-40 ug protein
How many different experimental trials were conducted using the antibody sample?Two
How was this sample prepared?Cell lysate or tissue homogenate was prepared in  RIPA buffer with PMSF and PIC
Primary antibody dilution and incubation time:1:500 , overnight
Secondary antibody used and dilution and incubation time:1:5000, 1 hour
What controls were used in your experiment (positive/negative)?No
Please include your detailed WB Procedure/Protocol here:Protein from N2a cells were extracted by lysing them in appropriate amount of RIPA buffer ( with Protease inhibitor cocktail and PMSF) . Protein from mouse kidney and liver tissue were extracted by homogenizing in appropriate amount of RIPA buffer. ~30-60 ug of protein were loaded in each well transferred to a PVDF membrane, blocked for 1 hour, incubated with primary antibody dilution of 1:500 in 5%Milk  for overnight followed by washing and incubation with secondary antibody 1: 2500 in 5% milk.

Product Protocols: GATA2 antibody tested with Human K562 Cells (ARP31855_T100)

Aviva Systems Biology is the original manufacturer of this GATA2 antibody (ARP31855_T100)

Product Datasheet Link: GATA2 antibody (ARP31855_T100)

WB Suggested Anti-GATA2 antibody Dilution: 1:1000 (stock 1mg/mL)
Amount of lysate: 25ug
Sample type: Human K562
Blocking buffer: TBST-3% milk
Primary antibody concentration: 1ug/mL
Primary antibody incubation time: 4hrs at RT with shaking
Secondary antibody: Goat anti-rabbit-Hrp
Secondary antibody concentration: 0.1ug/mL
Secondary antibody incubation time: 1hr at RT with shaking

Western Blot image: 

Description of Target: The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GATA2 antibody (ARP31855_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question