ARRB2 Antibody - middle region (ARP48007_P050)

Catalog No: ARP48007_P050

Sample Type: HepG2 cell lysate
Antibody concentration: 1.0 ug/ml
Gel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2

Sample Type:
Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution:
1:1000 Secondary Antibody:
Anti-rabbit-HRP Secondary Antibody Dilution:
1:5000 Color/Signal Descriptions:
ARRB2 Gene Name:
Kathleen Gabrielson Submitted by:

Human Skin

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARRB2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARRB2 (ARP48007_P050) antibody is Catalog # AAP48007 (Previous Catalog # AAPS20510)
• Sample Type Confirmation:

  ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Luan,B., (2005) EMBO J. 24 (24), 4237-4246

Target Info

• Gene Symbol: ARRB2
• Gene Full Name: Arrestin, beta 2
• Alias Symbols: ARB2, ARR2, BARR2
• NCBI Gene Id: 409
• Protein Name: Beta-arrestin-2
• Description of Target: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Uniprot ID: P32121
• Protein Accession #: NP_945355
• Nucleotide Accession #: NM_199004
• Protein Size (# AA): 409
• Molecular Weight: 46kDa
• Protein Interactions: UBC; SRC; MAPK9; INSR; AKT1; USP33; ADRB2; TBXA2R; CYTH1; PTGDS; BAI1; LIMK1; CFL1; CSK; AGTR1; MAP2K4; MAPK10; MAP3K5; GCG; NFKBIA; MDM2; IGF1R; CLTC; ADRB1; HIPK3; EDNRA; gag-pol; ARRDC3; ARRDC4; SIRT1; PDE4D; Mlnr; Trhr; C5AR1; SLC9A5; AP2M1; HCRTR1; F