Size:100 ul
$319.00
In Stock
SKU
ARP38253_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38253_P050-FITC Conjugated

ARP38253_P050-HRP Conjugated

ARP38253_P050-Biotin Conjugated

STAT3 Antibody - N-terminal region (ARP38253_P050)

Rating:
100% of 100
Catalog#: ARP38253_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, IF
Additional Information IHC Information: Kidney
IHC Information: Uterus
IHC Information: Prostate
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-STAT3 (ARP38253_P050)
Peptide Sequence Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-STAT3 (ARP38253_P050) antibody is Catalog # AAP38253 (Previous Catalog # AAPP23107)
Datasheets/Manuals Printable datasheet for anti-STAT3 (ARP38253_P050) antibody
Other Applications Image 1 Data Immunofluorescence --
Sample Type: Macrophages
Dilution: 1:1000
Target Reference Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Publications

Deng, W. et al. Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway. Cytotherapy 13, 431-40 (2011). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21174489

Deng, W; Chen, QW; Li, XS; Yuan, ZM; Li, GQ; Ke, DZ; Wang, L; Wu, ZQ; Luo, SL; Bone marrow mesenchymal stromal cells with CD47 high expression via the signal transducer and activators of transcription signaling pathway preventing myocardial fibrosis. 8, 10555-64 (2015). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26617765

Vega, V. L. et al. Activation of the stress response in macrophages alters the M1/M2 balance by enhancing bacterial killing and IL-10 expression. J. Mol. Med. (Berl). 92, 1305-17 (2014). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25163764

Gene Symbol STAT3
Official Gene Full Name Signal transducer and activator of transcription 3 (acute-phase response factor)
Alias Symbols APRF, FLJ20882, MGC16063, HIES
NCBI Gene Id 6774
Protein Name Signal transducer and activator of transcription 3 isoform 2 EMBL BAG70046.1
Description of Target STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot Id B5BTZ6
Protein Accession # NP_003141
Nucleotide Accession # NM_003150
Protein Size (# AA) 769
Molecular Weight 88kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
Protein Interactions MTOR; GADD45A; BMX; BLK; UBC; SYK; LMO2; SRI; HIC1; GNB2; USP22; RELA; COPS5; BRD4; ADRB2; PSMG3; TBCD; TBC1D15; PUS7; LUC7L2; ARFIP1; IVNS1ABP; MSH2; BMH1; SIN3A; EGFR; PIAS3; HDAC3; SRC; LYN; JAK3; JAK2; HES5; TRIM28; HES1; HCK; FYN; FGR; HNRNPM; SULT2A
  1. What is the species homology for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAT3 Antibody - N-terminal region (ARP38253_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    This target may also be called "APRF, FLJ20882, MGC16063, HIES" in publications.

  5. What is the shipping cost for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAT3 Antibody - N-terminal region (ARP38253_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "STAT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAT3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAT3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAT3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAT3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAT3 Antibody - N-terminal region (ARP38253_P050)
Your Rating
We found other products you might like!