Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP33327_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33327_P050-FITC Conjugated

ARP33327_P050-HRP Conjugated

ARP33327_P050-Biotin Conjugated

SOX11 Antibody - N-terminal region (ARP33327_P050)

Rating:
60% of 100
Catalog#: ARP33327_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17346 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SOX11
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data Anti-SOX11 (ARP33327_P050)
Peptide Sequence Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SOX11 (ARP33327_P050) antibody is Catalog # AAP33327 (Previous Catalog # AAPP04369)
Datasheets/Manuals Printable datasheet for anti-SOX11 (ARP33327_P050) antibody
Target Reference Wiebe,M.S., et al., (2003) J. Biol. Chem. 278 (20), 17901-17911
Publications

Li, Y. et al. Sox11 modulates neocortical development by regulating the proliferation and neuronal differentiation of cortical intermediate precursors. Acta Biochim. Biophys. Sin. (Shanghai). 44, 660-8 (2012). WB, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22687574

Gene Symbol SOX11
Official Gene Full Name SRY (sex determining region Y)-box 11
NCBI Gene Id 6664
Protein Name Transcription factor SOX-11
Description of Target This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Swissprot Id P35716
Protein Accession # NP_003099
Nucleotide Accession # NM_003108
Protein Size (# AA) 441
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SOX11.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SOX11.
Protein Interactions POU3F3; POU3F2;
  1. What is the species homology for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOX11 Antibody - N-terminal region (ARP33327_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOX11 Antibody - N-terminal region (ARP33327_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SOX11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOX11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOX11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOX11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOX11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOX11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOX11 Antibody - N-terminal region (ARP33327_P050)
Your Rating
We found other products you might like!