Size:100 ul
$229.00
In Stock
SKU
ARP47759_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47759_T100-FITC Conjugated

ARP47759_T100-HRP Conjugated

ARP47759_T100-Biotin Conjugated

GAS7 Antibody - C-terminal region (ARP47759_T100)

Rating:
90% of 100
Catalog#: ARP47759_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292307 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-GAS7 (ARP47759_T100)
Peptide Sequence Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GAS7 (ARP47759_T100) antibody is Catalog # AAP47759 (Previous Catalog # AAPS22511)
Datasheets/Manuals Printable datasheet for anti-GAS7 (ARP47759_T100) antibody
Target Reference Chao,C.C., (2005) J. Neurosci. Res. 81 (2), 153-162
Gene Symbol GAS7
Official Gene Full Name Growth arrest-specific 7
Alias Symbols KIAA0394, MGC1348, MLL/GAS7
NCBI Gene Id 8522
Protein Name Growth arrest-specific protein 7
Description of Target The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described.
Swissprot Id Q7Z571
Protein Accession # NP_958839
Nucleotide Accession # NM_201433
Protein Size (# AA) 476
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GAS7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GAS7.
Protein Interactions WDYHV1; GAS7; APBB1IP; CYFIP2; CYFIP1; NCKAP1; KHDRBS1; SF3A1; WASF2; ABI1; SF1; WAS; SFPQ; RPLP0; HNRNPU; NCKAP1L; GAPDH; DIAPH1; FMNL1; CREB3L2; ATXN1L; PACSIN1; ACTA1;
  1. What is the species homology for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GAS7 Antibody - C-terminal region (ARP47759_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    This target may also be called "KIAA0394, MGC1348, MLL/GAS7" in publications.

  5. What is the shipping cost for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GAS7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GAS7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GAS7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GAS7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GAS7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GAS7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GAS7 Antibody - C-terminal region (ARP47759_T100)
Your Rating
We found other products you might like!