Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
P100601_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100601_P050-FITC Conjugated

P100601_P050-HRP Conjugated

P100601_P050-Biotin Conjugated

CTNNB1 Antibody - C-terminal region (P100601_P050)

Rating:
80% of 100
Catalog#: P100601_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116622 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Complete computational species homology data Anti-CTNNB1 (P100601_P050)
Peptide Sequence Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CTNNB1 (P100601_P050) antibody is Catalog # AAP30904 (Previous Catalog # AAPP01628)
Datasheets/Manuals Printable datasheet for anti-CTNNB1 (P100601_P050) antibody
Sample Type Confirmation

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference Jiang,X., (2008) Cancer Cell 13 (6), 529-541
Publications

Li, S; Yang, X; Tang, S; Zhang, X; Feng, Z; Cui, S; Repair of massively defected hemi-joints using demineralized osteoarticular allografts with protected cartilage. 26, 227 (2015). CHIP, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish 26319778

Gene Symbol CTNNB1
Official Gene Full Name Catenin (cadherin-associated protein), beta 1, 88kDa
Alias Symbols CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
NCBI Gene Id 1499
Protein Name Catenin beta-1
Description of Target Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-54 DA216720.1 1-54 55-2626 X87838.1 1-2572 2627-3720 AC104307.2 83770-84863
Swissprot Id P35222
Protein Accession # NP_001895
Nucleotide Accession # NM_001904
Protein Size (# AA) 781
Molecular Weight 85kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
Protein Interactions PPARD; PLA2G4A; FBXO45; BTRC; SUMO1; UBC; HUWE1; CDH5; CDH2; TCF4; TBL1X; SOX1; SKP1; RNF220; CACYBP; FBXW11; SUMO2; SIAH1; Apc2; COPS5; RNF14; CDH1; SP1; KCTD1; MDM2; UBE2B; GSK3B; NEK2; RBX1; PTGS2; STRN3; LATS2; APC; ELAVL1; AMOT; ABL1; AXIN1; CBL; LEF
  1. What is the species homology for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish".

  2. How long will it take to receive "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTNNB1 Antibody - C-terminal region (P100601_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    This target may also be called "CTNNB, DKFZp686D02253, FLJ25606, FLJ37923" in publications.

  5. What is the shipping cost for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "85kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTNNB1 Antibody - C-terminal region (P100601_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CTNNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTNNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTNNB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTNNB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTNNB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTNNB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTNNB1 Antibody - C-terminal region (P100601_P050)
Your Rating
We found other products you might like!