Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
AVARP06008_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP06008_P050-FITC Conjugated

AVARP06008_P050-HRP Conjugated

AVARP06008_P050-Biotin Conjugated

AKT1 Antibody - N-terminal region (AVARP06008_P050)

Rating:
80% of 100
Catalog#: AVARP06008_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Frog, Baboon
Predicted Species Reactivity Cow, Dog, Goat, Human, Mouse, Pig, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135829 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86%
Complete computational species homology data Anti-AKT1 (AVARP06008_P050)
Peptide Sequence Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AKT1 (AVARP06008_P050) antibody is Catalog # AAP30466
Datasheets/Manuals Printable datasheet for anti-AKT1 (AVARP06008_P050) antibody
Target Reference Kim,H.A., et al., (2006) Exp. Mol. Pathol. 80 (2), 165-170
Gene Symbol AKT1
Official Gene Full Name V-akt murine thymoma viral oncogene homolog 1
Alias Symbols AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA
NCBI Gene Id 207
Protein Name RAC-alpha serine/threonine-protein kinase
Description of Target AKT1 is a general protein kinase capable of phosphorylating several known proteins.The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
Swissprot Id P31749
Protein Accession # NP_005154
Nucleotide Accession # NM_005163
Protein Size (# AA) 480
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AKT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AKT1.
  1. What is the species homology for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    The tested species reactivity for this item is "Human, Frog, Baboon". This antibody is predicted to have homology to "Cow, Dog, Goat, Human, Mouse, Pig, Rat, Sheep".

  2. How long will it take to receive "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AKT1 Antibody - N-terminal region (AVARP06008_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    This target may also be called "AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA" in publications.

  5. What is the shipping cost for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AKT1 Antibody - N-terminal region (AVARP06008_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AKT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AKT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AKT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AKT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AKT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AKT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AKT1 Antibody - N-terminal region (AVARP06008_P050)
Your Rating
We found other products you might like!