AMOTL1 Antibody - N-terminal region (ARP42927_P050)

Catalog No: ARP42927_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is contained in a few smaller isoforms of the protein, including isoform 2 at 101 kDa.

WB Suggested Anti-AMOTL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Publications:

  Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). 22558212

Target Info

• Gene Symbol: AMOTL1
• Gene Full Name: Angiomotin like 1
• Alias Symbols: JEAP
• NCBI Gene Id: 154810
• Protein Name: Angiomotin-like protein 1
• Description of Target: AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
• Uniprot ID: Q8IY63
• Protein Accession #: NP_570899
• Nucleotide Accession #: NM_130847
• Protein Size (# AA): 956
• Molecular Weight: 107 kDa
• Protein Interactions: WWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L;