Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP34121_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34121_T100-FITC Conjugated

ARP34121_T100-HRP Conjugated

ARP34121_T100-Biotin Conjugated

XRCC5 Antibody - C-terminal region (ARP34121_T100)

Rating:
80% of 100
Catalog#: ARP34121_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135964 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-XRCC5 (ARP34121_T100)
Peptide Sequence Synthetic peptide located within the following region: GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-XRCC5 (ARP34121_T100) antibody is Catalog # AAP34121 (Previous Catalog # AAPP05592)
Datasheets/Manuals Printable datasheet for anti-XRCC5 (ARP34121_T100) antibody
Sample Type Confirmation

XRCC5 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Sawchuk,D.J., et al., (2004) J. Biol. Chem. 279 (28), 29821-29831
Gene Symbol XRCC5
Official Gene Full Name X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Alias Symbols KU80, KUB2, Ku86, NFIV, KARP1, KARP-1
NCBI Gene Id 7520
Protein Name X-ray repair cross-complementing protein 5
Description of Target XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
Swissprot Id Q4VBQ5
Protein Accession # NP_066964
Nucleotide Accession # NM_021141
Protein Size (# AA) 732
Molecular Weight 83kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express XRCC5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express XRCC5.
Protein Interactions HUWE1; UBC; EHF; ELF3; SUMO2; SUMO3; BRCA1; ATRX; Fbxl16; NEDD8; SUMO1; MDM2; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; BMI1; EIF4B; C1QBP; RPL24; PLCB3; PRMT3; EIF3J; CUL2; CSDE1; SF1; TRMT1; SAMHD1; DNMBP; GANAB; HYOU1; NCL; NARS; MSH2; JUP; HSPA4; PARP1; TAR
  1. What is the species homology for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "XRCC5 Antibody - C-terminal region (ARP34121_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    This target may also be called "KU80, KUB2, Ku86, NFIV, KARP1, KARP-1" in publications.

  5. What is the shipping cost for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "XRCC5 Antibody - C-terminal region (ARP34121_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "XRCC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "XRCC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "XRCC5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "XRCC5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "XRCC5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "XRCC5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:XRCC5 Antibody - C-terminal region (ARP34121_T100)
Your Rating
We found other products you might like!