Size:100 ul
$229.00
In Stock
SKU
ARP32378_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32378_T100-FITC Conjugated

ARP32378_T100-HRP Conjugated

ARP32378_T100-Biotin Conjugated

RUVBL2 Antibody - N-terminal region (ARP32378_T100)

Rating:
100% of 100
Catalog#: ARP32378_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-136058 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
Complete computational species homology dataAnti-RUVBL2 (ARP32378_T100)
Peptide SequenceSynthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-RUVBL2 (ARP32378_T100) antibody is Catalog # AAP32378 (Previous Catalog # AAPP03368)
Datasheets/ManualsPrintable datasheet for anti-RUVBL2 (ARP32378_T100) antibody
Sample Type Confirmation

RUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi

Target ReferenceBauer,A., et al., (2000) EMBO J.19(22),6121-6130
Gene SymbolRUVBL2
Official Gene Full NameRuvB-like 2 (E. coli)
Alias SymbolsRVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, REPTIN, TIP49B
NCBI Gene Id10856
Protein NameRuvB-like 2
Description of TargetRuvB-Like 2 (48-kDa TATA box-binding protein-interacting protein, Reptin 52, RUVBL2) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this protein has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
Swissprot IdQ9Y230
Protein Accession #NP_006657
Nucleotide Accession #NM_006666
Protein Size (# AA)463
Molecular Weight51kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RUVBL2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RUVBL2.
Protein InteractionsCCDC103; LNX1; RUVBL1; UBC; DPCD; HUWE1; VCP; SUMO2; RPAP3; MDM2; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; BMI1; CDKN2A; ASNA1; PPP6R3; PLA2G4A; PARK2; FBXO6; TARDBP; YWHAQ; PPP6R2; EXOSC10; BAG3; POLR2E; UPF1; SMG1; RBM8A; TTI1; PAN2; TBP; CTNNB1; STOM; RUVBL
Write Your Own Review
You're reviewing:RUVBL2 Antibody - N-terminal region (ARP32378_T100)
Your Rating
Aviva Tips and Tricks
Aviva ChIP Antibodies
Aviva Blast Tool
Free Microscope