SOX10 Antibody - middle region (ARP33326_P050)

Catalog No: ARP33326_P050

Host: Rabbit
Target Name: SOX10
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 3ug/ml

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Immunohistochemistry with Skin tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody (ARP33326_P050)

Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody (ARP33326_P050)

A/ [IHC-PZ] (optimal processing) human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns A2/ [IHC-PZ + FF] As above for initial fixation then post-fixed in 10% buffered formalin for 5 days B/ [IHC-P] human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns Controls Negative: omission of primary. Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SOX10 (ARP33326_P050) antibody is Catalog # AAP33326
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Publications:

  Chromatin landscape defined by repressive histone methylation during oligodendrocyte differentiation. J Neurosci. 35, 352-65 (2015). 25568127

  SPECC1L deficiency results in increased adherens junction stability and reduced cranial neural crest cell delamination. Sci Rep. 6, 17735 (2016). 26787558

• Description:
  View product citations for SOX10 Antibody - middle region (ARP33326_P050) on CiteAb

Target Info

• Gene Symbol: SOX10
• Gene Full Name: SRY (sex determining region Y)-box 10
• Alias Symbols: DOM, WS4, PCWH, WS2E, WS4C
• NCBI Gene Id: 6663
• Protein Name: Transcription factor SOX-10
• Description of Target: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Uniprot ID: P56693
• Protein Accession #: NP_008872
• Nucleotide Accession #: NM_006941
• Protein Size (# AA): 466
• Molecular Weight: 50 kDa
• Protein Interactions: UBC; CDK6; EXOC5; NMI; EPAS1; POU3F2; UTF1; PAX3; UBE2I; OLIG2; HHEX; PAX6; ALX4; PRRX2; SUMO2; POU3F3; SUMO3; SOX10; SUMO1; TCF12; MEOX1; DLX5; HIVEP1; SP1; PRRX1; JUN; POU5F1; HOXC4; HOXA3; EGR2; CEBPA;