Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOX10 Antibody - middle region (ARP33326_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP33326_P050-FITC Conjugated

ARP33326_P050-HRP Conjugated

ARP33326_P050-Biotin Conjugated

Gene Symbol:
SOX10
NCBI Gene Id:
6663
Official Gene Full Name:
SRY (sex determining region Y)-box 10
Protein Name:
Transcription factor SOX-10
Swissprot Id:
P56693
Protein Accession #:
NP_008872
Nucleotide Accession #:
NM_006941
Alias Symbols:
DOM, MGC15649, WS2E, WS4, PCWH, WS4C
Replacement Item:
This antibody may replace item sc-17342 from Santa Cruz Biotechnology.
Description of Target:
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Protein Size (# AA):
466
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX10.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOX10
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-SOX10 (ARP33326_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CDK6; EXOC5; NMI; EPAS1; POU3F2; UTF1; PAX3; UBE2I; OLIG2; HHEX; PAX6; ALX4; PRRX2; SUMO2; POU3F3; SUMO3; SOX10; SUMO1; TCF12; MEOX1; DLX5; HIVEP1; SP1; PRRX1; JUN; POU5F1; HOXC4; HOXA3; EGR2; CEBPA;
Blocking Peptide:
For anti-SOX10 (ARP33326_P050) antibody is Catalog # AAP33326
Datasheets/Manuals:
Printable datasheet for anti-SOX10 (ARP33326_P050) antibody
Publications:

Wilson, NR; Olm-Shipman, AJ; Acevedo, DS; Palaniyandi, K; Hall, EG; Kosa, E; Stumpff, KM; Smith, GJ; Pitstick, L; Liao, EC; Bjork, BC; Czirok, A; Saadi, I; SPECC1L deficiency results in increased adherens junction stability and reduced cranial neural crest cell delamination. 6, 17735 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26787558

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

335/12/2018 21:18
  • Overall Experience:
  • Quality:
Western Blot with HEK293

Submitted by:
Sergey Ivanov
Vanderbilt University

What type of experimental sample are you using and how did you prepare it?

We are using HEK293 whole cell lysates with Aviva protocol.

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

The primary antibodies were tested in Western blot experiments at 1:4,000, secondary antibody was used at 1:10,000 dilution.

What controls were used in your experiment? Please include your positive control.

p53 is used as a positive control; protein transfer was monitored via Ponceau staining.

How did you store the antibody after re-suspension?

Frozen at -20 C in aliquots.

Please provide the protocol for your application procedure. Please be as detailed as possible.

Experiment done using the Aviva protocol. All antibodies show virtually no background.

How would you rate this antibody on a scale from 1-5? Why?

excellent (5, produced unique bands with expected sizes)

Would you use this antibody in future experiments?

yes

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...