Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP46421_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46421_P050-FITC Conjugated

ARP46421_P050-HRP Conjugated

ARP46421_P050-Biotin Conjugated

SEMA4F Antibody - N-terminal region (ARP46421_P050)

Rating:
80% of 100
Catalog#: ARP46421_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-135264 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-SEMA4F (ARP46421_P050)
Peptide SequenceSynthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SEMA4F (ARP46421_P050) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Datasheets/ManualsPrintable datasheet for anti-SEMA4F (ARP46421_P050) antibody
Gene SymbolSEMA4F
Official Gene Full NameSema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Alias SymbolsSEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
NCBI Gene Id10505
Protein NameSemaphorin-4F
Description of TargetSEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Swissprot IdO95754-2
Protein Accession #AAH18361
Nucleotide Accession #NM_004263
Protein Size (# AA)615
Molecular Weight67kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SEMA4F.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SEMA4F.
Protein InteractionsDLG4; NRP2;
Write Your Own Review
You're reviewing:SEMA4F Antibody - N-terminal region (ARP46421_P050)
Your Rating
Aviva Travel Grant
Aviva Pathways
Aviva HIS tag Deal
Aviva Blast Tool