Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57798_P050-FITC Conjugated

ARP57798_P050-HRP Conjugated

ARP57798_P050-Biotin Conjugated

RAC1 Antibody - middle region (ARP57798_P050)

100% of 100
Catalog#: ARP57798_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-116394 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RAC1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-RAC1 (ARP57798_P050)
Peptide SequenceSynthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-RAC1 (ARP57798_P050) antibody is Catalog # AAP57798 (Previous Catalog # AAPP44117)
Datasheets/ManualsPrintable datasheet for anti-RAC1 (ARP57798_P050) antibody
Gene SymbolRAC1
Official Gene Full NameRas-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Alias SymbolsMGC111543, MIG5, TC-25, p21-Rac1, Rac-1
NCBI Gene Id5879
Protein NameRas-related C3 botulinum toxin substrate 1
Description of TargetThe protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot IdP63000-2
Protein Accession #NP_008839
Nucleotide Accession #NM_006908
Protein Size (# AA)192
Molecular Weight21kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RAC1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RAC1.
Write Your Own Review
You're reviewing:RAC1 Antibody - middle region (ARP57798_P050)
Your Rating
Aviva Tissue Tool
Aviva ChIP Antibodies
Assay Development
Aviva Validation Data