Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RER1 antibody - middle region (ARP46815_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP46815_P050-FITC Conjugated

ARP46815_P050-HRP Conjugated

ARP46815_P050-Biotin Conjugated

Gene Symbol:
RER1
NCBI Gene Id:
11079
Official Gene Full Name:
RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)
Protein Name:
Protein RER1
Swissprot Id:
O15258
Protein Accession #:
NP_008964
Nucleotide Accession #:
NM_007033
Alias Symbols:
RP4-740C4.2
Replacement Item:
This antibody may replace item sc-152808 from Santa Cruz Biotechnology.
Description of Target:
RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.
Protein Size (# AA):
196
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RER1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RER1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RER1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-RER1 (ARP46815_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SYVN1; UBC; RNF2; env; UBL4A; SH3GL3; HAP1; IMMT;
Blocking Peptide:
For anti-RER1 (ARP46815_P050) antibody is Catalog # AAP46815 (Previous Catalog # AAPP27613)
Datasheets/Manuals:
Printable datasheet for anti-RER1 (ARP46815_P050) antibody
Target Reference:
Kaether,C., (2007) EMBO Rep. 8 (8), 743-748

Tell us what you think about this item!

Write A Review
    Please, wait...