Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

RELA Antibody - N-terminal region (P100779_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100779_T100-FITC Conjugated

P100779_T100-HRP Conjugated

P100779_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
V-rel reticuloendotheliosis viral oncogene homolog A (avian)
NCBI Gene Id:
Protein Name:
Transcription factor p65
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
p65, NFKB3
Replacement Item:
This antibody may replace item sc-109 from Santa Cruz Biotechnology.
Description of Target:
p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RELA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RELA.
The immunogen is a synthetic peptide directed towards the N terminal region of human RELA
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-RELA (P100779_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RELA (P100779_T100) antibody is Catalog # AAP31111 (Previous Catalog # AAPP01850)
Printable datasheet for anti-RELA (P100779_T100) antibody
Target Reference:
Ruben, S.M., et al., (1991) Science 251 (5000) 1490-1493.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...