Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
P100779_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100779_T100-FITC Conjugated

P100779_T100-HRP Conjugated

P100779_T100-Biotin Conjugated

RELA Antibody - N-terminal region (P100779_T100)

Catalog#: P100779_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RELA
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-RELA (P100779_T100)
Peptide Sequence Synthetic peptide located within the following region: VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RELA (P100779_T100) antibody is Catalog # AAP31111 (Previous Catalog # AAPP01850)
Datasheets/Manuals Printable datasheet for anti-RELA (P100779_T100) antibody
Target Reference Ruben, S.M., et al., (1991) Science 251 (5000) 1490-1493.
Gene Symbol RELA
Official Gene Full Name V-rel reticuloendotheliosis viral oncogene homolog A (avian)
Alias Symbols p65, NFKB3
NCBI Gene Id 5970
Protein Name Transcription factor p65
Description of Target p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex.
Swissprot Id Q04206
Protein Accession # NP_068810
Nucleotide Accession # NM_021975
Protein Size (# AA) 551
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RELA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RELA.
Protein Interactions GAN; CCND1; ABCA1; UBC; TCF4; SRSF7; RELA; REL; PRKDC; PLG; PEX1; NFKB2; NFKB1; MUC3A; KRT5; REV1; TXN2; FBXW11; IL1RN; IKBKB; HSPA5; HDAC1; EP300; CREBBP; MAP3K8; CHEK1; CDKN2A; CDK4; SPATA31A3; POTEJ; POTEE; PIWIL4; DIS3L2; DCD; IKBKG; CHUK; PLA2G4A; ST
Write Your Own Review
You're reviewing:RELA Antibody - N-terminal region (P100779_T100)
Your Rating