Search Antibody, Protein, and ELISA Kit Solutions

RELA Antibody - N-terminal region (P100779_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100779_T100-FITC Conjugated

P100779_T100-HRP Conjugated

P100779_T100-Biotin Conjugated

Gene Symbol:
RELA
Official Gene Full Name:
V-rel reticuloendotheliosis viral oncogene homolog A (avian)
NCBI Gene Id:
5970
Protein Name:
Transcription factor p65
Swissprot Id:
Q04206
Protein Accession #:
NP_068810
Nucleotide Accession #:
NM_021975
Alias Symbols:
p65, NFKB3
Replacement Item:
This antibody may replace item sc-109 from Santa Cruz Biotechnology.
Description of Target:
p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex.
Protein Size (# AA):
551
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RELA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RELA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RELA
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-RELA (P100779_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GAN; CCND1; ABCA1; UBC; TCF4; SRSF7; RELA; REL; PRKDC; PLG; PEX1; NFKB2; NFKB1; MUC3A; KRT5; REV1; TXN2; FBXW11; IL1RN; IKBKB; HSPA5; HDAC1; EP300; CREBBP; MAP3K8; CHEK1; CDKN2A; CDK4; SPATA31A3; POTEJ; POTEE; PIWIL4; DIS3L2; DCD; IKBKG; CHUK; PLA2G4A; ST
Blocking Peptide:
For anti-RELA (P100779_T100) antibody is Catalog # AAP31111 (Previous Catalog # AAPP01850)
Datasheets/Manuals:
Printable datasheet for anti-RELA (P100779_T100) antibody
Target Reference:
Ruben, S.M., et al., (1991) Science 251 (5000) 1490-1493.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...