- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RELA (ARP30371_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Pig |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB, IHC |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RELA |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RELA (ARP30371_P050-Biotin) antibody is Catalog # AAP30371 (Previous Catalog # AAPS08809) |
Sample Type Confirmation | RELA is supported by BioGPS gene expression data to be expressed in HeLa |
Reference | Wittwer,T. (2008) Biochem. Biophys. Res. Commun. 371 (2), 294-297 |
Gene Symbol | RELA |
---|---|
Gene Full Name | V-rel reticuloendotheliosis viral oncogene homolog A (avian) |
Alias Symbols | p65, CMCU, NFKB3 |
NCBI Gene Id | 5970 |
Protein Name | Transcription factor p65 |
Description of Target | p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1760 M62399.1 8-1767 |
Uniprot ID | Q04206 |
Protein Accession # | NP_068810 |
Nucleotide Accession # | NM_021975 |
Protein Size (# AA) | 551 |
Molecular Weight | 60kDa |
Protein Interactions | GAN; CCND1; ABCA1; UBC; TCF4; SRSF7; RELA; REL; PRKDC; PLG; PEX1; NFKB2; NFKB1; MUC3A; KRT5; REV1; TXN2; FBXW11; IL1RN; IKBKB; HSPA5; HDAC1; EP300; CREBBP; MAP3K8; CHEK1; CDKN2A; CDK4; SPATA31A3; POTEJ; POTEE; PIWIL4; DIS3L2; DCD; IKBKG; CHUK; PLA2G4A; ST |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig".
-
How long will it take to receive "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
This target may also be called "p65, CMCU, NFKB3" in publications.
-
What is the shipping cost for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "60kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RELA Antibody - middle region : Biotin (ARP30371_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RELA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RELA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RELA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RELA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RELA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RELA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.